Lineage for d1ddja_ (1ddj A:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 14823Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
  4. 14824Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 14909Family b.47.1.2: Eukaryotic proteases [50514] (33 proteins)
  6. 15141Protein Plasmin(ogen), catalytic domain [50588] (1 species)
  7. 15142Species Human (Homo sapiens) [TaxId:9606] [50589] (4 PDB entries)
  8. 15143Domain d1ddja_: 1ddj A: [26362]

Details for d1ddja_

PDB Entry: 1ddj (more details), 2 Å

PDB Description: crystal structure of human plasminogen catalytic domain

SCOP Domain Sequences for d1ddja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ddja_ b.47.1.2 (A:) Plasmin(ogen), catalytic domain {Human (Homo sapiens)}
sfdcgkpqvepkkcpgrvvggcvahphswpwqvslrtrfgmhfcggtlispewvltaahc
leksprpssykvilgahqevnlephvqeievsrlfleptrkdiallklsspavitdkvip
aclpspnyvvadrtecfitgwgetqgtfgagllkeaqlpvienkvcnryeflngrvqste
lcaghlaggtdscqgdaggplvcfekdkyilqgvtswglgcarpnkpgvyvrvsrfvtwi
egvmrnn

SCOP Domain Coordinates for d1ddja_:

Click to download the PDB-style file with coordinates for d1ddja_.
(The format of our PDB-style files is described here.)

Timeline for d1ddja_: