Lineage for d4q0nb_ (4q0n B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706693Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2706694Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 2706927Family a.29.2.0: automated matches [191428] (1 protein)
    not a true family
  6. 2706928Protein automated matches [190615] (15 species)
    not a true protein
  7. 2706959Species Human (Homo sapiens) [TaxId:9606] [187641] (1052 PDB entries)
  8. 2707443Domain d4q0nb_: 4q0n B: [263590]
    automated match to d2yqda_
    protein/DNA complex; complexed with 2xd, edo

Details for d4q0nb_

PDB Entry: 4q0n (more details), 1.78 Å

PDB Description: Crystal Structure of the fifth bromodomain of Human Poly-bromodomain containing protein 1 (PB1) in complex with a hydroxyphenyl-propenone ligand
PDB Compounds: (B:) Protein polybromo-1

SCOPe Domain Sequences for d4q0nb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4q0nb_ a.29.2.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kymtpmqqklnevyeavknytdkrgrrlsaiflrlpsrselpdyyltikkpmdmekirsh
mmankyqdidsmvedfvmmfnnactynepesliykdalvlhkvlletrrdl

SCOPe Domain Coordinates for d4q0nb_:

Click to download the PDB-style file with coordinates for d4q0nb_.
(The format of our PDB-style files is described here.)

Timeline for d4q0nb_: