Lineage for d4pn3c_ (4pn3 C:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1826588Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1826589Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1830524Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 1830525Protein automated matches [190069] (203 species)
    not a true protein
  7. 1830802Species Brucella melitensis [TaxId:1160220] [257516] (1 PDB entry)
  8. 1830805Domain d4pn3c_: 4pn3 C: [263547]
    automated match to d4pn3a_
    complexed with trs

Details for d4pn3c_

PDB Entry: 4pn3 (more details), 2.15 Å

PDB Description: Crystal structure of 3-hydroxyacyl-CoA-dehydrogenase from Brucella melitensis
PDB Compounds: (C:) 3-hydroxyacyl-CoA dehydrogenase

SCOPe Domain Sequences for d4pn3c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pn3c_ c.2.1.0 (C:) automated matches {Brucella melitensis [TaxId: 1160220]}
hhhhmqienrvflitgagsglgaavskmaveagakvvlldvnaeageagakalgasarfq
rtdvasdtdgkaaiaaaieafsridvlvncagvapgekvlgregahkletftrtisinli
gtfnmlrlaaeamaknepgqggergviintasvaafdgqigqaaysaskggvaamtlpva
relarhgirvmtiapgifktpmmagmpqevqdalgasvpfpprlgepaeyaalvrhiven
qmlngevirldgalrmaak

SCOPe Domain Coordinates for d4pn3c_:

Click to download the PDB-style file with coordinates for d4pn3c_.
(The format of our PDB-style files is described here.)

Timeline for d4pn3c_: