SCOPe 2.06: Domain d4pmud_: 4pmu D:

Lineage for d4pmud_ (4pmu D:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.0: automated matches [191314] (1 protein)
   not a true family

6. Protein automated matches [190075] (90 species)
   not a true protein

7. Species Xanthomonas axonopodis [TaxId:190486] [260217] (12 PDB entries)

8. Domain d4pmud_: 4pmu D: [263542]
   automated match to d4pmub_

Details for d4pmud_

PDB Entry: 4pmu, 2.86 Å

PDB Description: crystal structure of a novel reducing-end xylose-releasing exo- oligoxylanase (xyna) belonging to gh10 family (space group p1211)

PDB Compounds: (D:) Endo-1,4-beta-xylanase A

SCOPe Domain Sequences for d4pmud_:

Sequence; same for both SEQRES and ATOM records:

>d4pmud_ c.1.8.0 (D:) automated matches {Xanthomonas axonopodis [TaxId: 190486]}
tslkqayaqgfllgtavnadivsgkdaasaalvachfnavtaenvmkaevvaprrgvqdf
saadafvayaqrdrqfvvghtlvwhnqtpewffttadgrpntpaqqlermrahiaavagr
ytgkvqawdvvneiidedgsyrstnwvqrvgdgdtvvrnafafaqryapdaqlyyndfna
wrpakregivrmvkmlqqagvridgvgmqghwglnypslrdiedaidayaalgvkvmite
ldidvlpltkegqiigtgmahkqfqlpefkrfldpyrdglpadvqaqlrdryaelfalfw
rkrdkiarvsvwgvsddmswkndypvpgrtnypllfdrnhqpkpaldavvavpsa

Timeline for d4pmud_:

• d4pmud_ first appeared in SCOPe 2.05
  
• d4pmud_ appears in SCOPe 2.07
  
• d4pmud_ appears in the current release, SCOPe 2.08