Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (16 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187221] (698 PDB entries) |
Domain d4pjxf2: 4pjx F:117-241 [263541] Other proteins in same PDB: d4pjxa1, d4pjxa2, d4pjxa3, d4pjxb1, d4pjxb2, d4pjxc1, d4pjxc2, d4pjxd_, d4pjxe1, d4pjxf1, d4pjxg1, d4pjxh1 automated match to d3of6b2 complexed with 30w, b3p, cl, gol |
PDB Entry: 4pjx (more details), 2.25 Å
SCOPe Domain Sequences for d4pjxf2:
Sequence, based on SEQRES records: (download)
>d4pjxf2 b.1.1.2 (F:117-241) automated matches {Human (Homo sapiens) [TaxId: 9606]} lknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqp lkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivs aeawg
>d4pjxf2 b.1.1.2 (F:117-241) automated matches {Human (Homo sapiens) [TaxId: 9606]} lknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqp lkeqpalndsryalssrlrvsatfwqnphfrcqvqfyglsendewtqdrakpvtqivsae awg
Timeline for d4pjxf2: