Lineage for d4pjtb2 (4pjt B:797-1010)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3000428Fold d.166: ADP-ribosylation [56398] (1 superfamily)
    unusual fold
  4. 3000429Superfamily d.166.1: ADP-ribosylation [56399] (8 families) (S)
  5. 3000733Family d.166.1.0: automated matches [191650] (1 protein)
    not a true family
  6. 3000734Protein automated matches [191197] (13 species)
    not a true protein
  7. 3000809Species Human (Homo sapiens) [TaxId:9606] [225406] (56 PDB entries)
  8. 3000881Domain d4pjtb2: 4pjt B:797-1010 [263536]
    Other proteins in same PDB: d4pjta1, d4pjtb1, d4pjtc1, d4pjtd1
    automated match to d4hhyd2
    complexed with 2yq, gol, so4

Details for d4pjtb2

PDB Entry: 4pjt (more details), 2.35 Å

PDB Description: structure of parp1 catalytic domain bound to inhibitor bmn 673
PDB Compounds: (B:) Poly [ADP-ribose] polymerase 1

SCOPe Domain Sequences for d4pjtb2:

Sequence, based on SEQRES records: (download)

>d4pjtb2 d.166.1.0 (B:797-1010) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lktdikvvdrdseeaeiirkyvknthatthnaydlevidifkieregecqrykpfkqlhn
rrllwhgsrttnfagilsqglriappeapvtgymfgkgiyfadmvsksanychtsqgdpi
glillgevalgnmyelkhashisklpkgkhsvkglgkttpdpsanisldgvdvplgtgis
sgvndtsllyneyivydiaqvnlkyllklkfnfk

Sequence, based on observed residues (ATOM records): (download)

>d4pjtb2 d.166.1.0 (B:797-1010) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lktdikvvdrdseeaeiirkyvknthatthnaydlevidifkieregecqrykpfkqlhn
rrllwhgsrttnfagilsqglriappeapvtgymfgkgiyfadmvsksanychtsqgdpi
glillgevalgnmyelkhassklpkgkhsvkglgkttpdpsanisldgvdvplgtgissg
vndtsllyneyivydiaqvnlkyllklkfnfk

SCOPe Domain Coordinates for d4pjtb2:

Click to download the PDB-style file with coordinates for d4pjtb2.
(The format of our PDB-style files is described here.)

Timeline for d4pjtb2: