Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.0: automated matches [227140] (1 protein) not a true family |
Protein automated matches [226842] (4 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [226044] (42 PDB entries) |
Domain d4pjhc1: 4pjh C:1-178 [263533] Other proteins in same PDB: d4pjha2, d4pjhb_, d4pjhc2, d4pjhd_, d4pjhe1, d4pjhe2, d4pjhf1, d4pjhf2, d4pjhg1, d4pjhg2, d4pjhh1, d4pjhh2 automated match to d4l4vc1 complexed with 30w, gol, na |
PDB Entry: 4pjh (more details), 2 Å
SCOPe Domain Sequences for d4pjhc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pjhc1 d.19.1.0 (C:1-178) automated matches {Human (Homo sapiens) [TaxId: 9606]} rthslryfrlgvsdpihgvpefisvgyvdshpittydsvtrqkeprapwmaenlapdhwe rytqllrgwqqmfkvelkrlqrhynhsgshtyqrmigcelledgsttgflqyaydgqdfl ifnkdtlswlavdnvahtikqaweanqhellyqknwleeeciawlkrfleygkdtlqr
Timeline for d4pjhc1: