SCOPe 2.04: Domain d1pfxc_: 1pfx C:

Lineage for d1pfxc_ (1pfx C:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)

6. Protein Coagulation factor IXa, protease domain [50583] (2 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [50584] (2 PDB entries)

8. Domain d1pfxc_: 1pfx C: [26353]
   Other proteins in same PDB: d1pfxl1, d1pfxl2, d1pfxl3
   complexed with 0g6

Details for d1pfxc_

PDB Entry: 1pfx, 3 Å

PDB Description: porcine factor ixa

PDB Compounds: (C:) factor ixa

SCOPe Domain Sequences for d1pfxc_:

Sequence; same for both SEQRES and ATOM records:

>d1pfxc_ b.47.1.2 (C:) Coagulation factor IXa, protease domain {Pig (Sus scrofa) [TaxId: 9823]}
ivggenakpgqfpwqvllngkidafcggsiinekwvvtaahciepgvkitvvageyntee
tepteqrrnviraiphhsynatvnkyshdialleldepltlnsyvtpiciadkeytnifl
kfgsgyvsgwgrvfnrgrsatilqylkvplvdratclrstkftiysnmfcagfheggkds
cqgdsggphvtevegtsfltgiiswgeecavkgkygiytkvsryvnwikektklt

Timeline for d1pfxc_:

• d1pfxc_ first appeared (with stable ids) in SCOP 1.55
  
• d1pfxc_ appears in SCOPe 2.03
  
• d1pfxc_ appears in SCOPe 2.05
  
• d1pfxc_ appears in the current release, SCOPe 2.08