SCOPe 2.05: Domain d4pjga1: 4pjg A:1-178

Lineage for d4pjga1 (4pjg A:1-178)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.0: automated matches [227140] (1 protein)
   not a true family

6. Protein automated matches [226842] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [226044] (42 PDB entries)

8. Domain d4pjga1: 4pjg A:1-178 [263528]
   Other proteins in same PDB: d4pjga2, d4pjgb_, d4pjgd_, d4pjge1, d4pjge2, d4pjgf1, d4pjgf2, d4pjgg1, d4pjgg2, d4pjgh1, d4pjgh2
   automated match to d4l4vc1
   complexed with 30w

Details for d4pjga1

PDB Entry: 4pjg, 2.4 Å

PDB Description: structure of human mr1-ac-6-fp in complex with human mait b-f3-c1 tcr

PDB Compounds: (A:) Major histocompatibility complex class I-related gene protein

SCOPe Domain Sequences for d4pjga1:

Sequence; same for both SEQRES and ATOM records:

>d4pjga1 d.19.1.0 (A:1-178) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rthslryfrlgvsdpihgvpefisvgyvdshpittydsvtrqkeprapwmaenlapdhwe
rytqllrgwqqmfkvelkrlqrhynhsgshtyqrmigcelledgsttgflqyaydgqdfl
ifnkdtlswlavdnvahtikqaweanqhellyqknwleeeciawlkrfleygkdtlqr

Timeline for d4pjga1:

• d4pjga1 is new in SCOPe 2.05-stable
  
• d4pjga1 appears in SCOPe 2.06
  
• d4pjga1 appears in the current release, SCOPe 2.08