Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (14 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187221] (409 PDB entries) |
Domain d4pjee2: 4pje E:111-198 [263525] Other proteins in same PDB: d4pjea1, d4pjea2, d4pjeb_, d4pjec1, d4pjec2, d4pjed_, d4pjee1, d4pjef1, d4pjeg1, d4pjeh1 automated match to d2f54d2 complexed with 30w, act, cl, gol, na |
PDB Entry: 4pje (more details), 1.95 Å
SCOPe Domain Sequences for d4pjee2:
Sequence, based on SEQRES records: (download)
>d4pjee2 b.1.1.2 (E:111-198) automated matches {Human (Homo sapiens) [TaxId: 9606]} iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns avawsnksdfacanafnnsiipedtffp
>d4pjee2 b.1.1.2 (E:111-198) automated matches {Human (Homo sapiens) [TaxId: 9606]} iqnpdpavyqlrvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavawsnks dfacanafnnsiipedtffp
Timeline for d4pjee2: