![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
![]() | Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) ![]() |
![]() | Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins) |
![]() | Protein Myeloblastin, PR3 [50581] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [50582] (1 PDB entry) |
![]() | Domain d1fujd_: 1fuj D: [26352] |
PDB Entry: 1fuj (more details), 2.2 Å
SCOPe Domain Sequences for d1fujd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fujd_ b.47.1.2 (D:) Myeloblastin, PR3 {Human (Homo sapiens) [TaxId: 9606]} ivggheaqphsrpymaslqmrgnpgshfcggtlihpsfvltaahclrdipqrlvnvvlga hnvrtqeptqqhfsvaqvflnnydaenklndilliqlsspanlsasvatvqlpqqdqpvp hgtqclamgwgrvgahdppaqvlqelnvtvvtffcrphnictfvprrkagicfgdsggpl icdgiiqgidsfviwgcatrlfpdfftrvalyvdwirstlr
Timeline for d1fujd_: