SCOPe 2.07: Domain d4pjde2: 4pjd E:111-198

Lineage for d4pjde2 (4pjd E:111-198)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (17 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1235 PDB entries)

8. Domain d4pjde2: 4pjd E:111-198 [263519]
   Other proteins in same PDB: d4pjda1, d4pjda2, d4pjda3, d4pjdb_, d4pjdc1, d4pjdc2, d4pjdc3, d4pjdd_, d4pjde1, d4pjdf1, d4pjdg1, d4pjdh1
   automated match to d2f54d2
   complexed with 2lj, gol

Details for d4pjde2

PDB Entry: 4pjd, 2.78 Å

PDB Description: structure of human mr1-5-op-ru in complex with human mait c-c10 tcr

PDB Compounds: (E:) TCR-alpha

SCOPe Domain Sequences for d4pjde2:

Sequence, based on SEQRES records:

>d4pjde2 b.1.1.2 (E:111-198) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffp

Sequence, based on observed residues (ATOM records):

>d4pjde2 b.1.1.2 (E:111-198) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrsvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavawsnd
facanafnnsiipedtffp

Timeline for d4pjde2:

• d4pjde2 first appeared in SCOPe 2.05
  
• d4pjde2 appears in SCOPe 2.06
  
• d4pjde2 appears in the current release, SCOPe 2.08