SCOPe 2.05: Domain d4pjda1: 4pjd A:0-178

Lineage for d4pjda1 (4pjd A:0-178)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.0: automated matches [227140] (1 protein)
   not a true family

6. Protein automated matches [226842] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [226044] (42 PDB entries)

8. Domain d4pjda1: 4pjd A:0-178 [263514]
   Other proteins in same PDB: d4pjda2, d4pjdb_, d4pjdc2, d4pjdd_, d4pjde1, d4pjde2, d4pjdf1, d4pjdf2, d4pjdg1, d4pjdg2, d4pjdh1, d4pjdh2
   automated match to d4l4vc1
   complexed with 2lj, gol

Details for d4pjda1

PDB Entry: 4pjd, 2.78 Å

PDB Description: structure of human mr1-5-op-ru in complex with human mait c-c10 tcr

PDB Compounds: (A:) Major histocompatibility complex class I-related gene protein

SCOPe Domain Sequences for d4pjda1:

Sequence; same for both SEQRES and ATOM records:

>d4pjda1 d.19.1.0 (A:0-178) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mrthslryfrlgvsdpihgvpefisvgyvdshpittydsvtrqkeprapwmaenlapdhw
erytqllrgwqqmfkvelkrlqrhynhsgshtyqrmigcelledgsttgflqyaydgqdf
lifnkdtlswlavdnvahtikqaweanqhellyqknwleeeciawlkrfleygkdtlqr

Timeline for d4pjda1:

• d4pjda1 is new in SCOPe 2.05-stable
  
• d4pjda1 appears in SCOPe 2.06
  
• d4pjda1 appears in the current release, SCOPe 2.08