SCOPe 2.05: Domain d4pjbc1: 4pjb C:0-178

Lineage for d4pjbc1 (4pjb C:0-178)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.0: automated matches [227140] (1 protein)
   not a true family

6. Protein automated matches [226842] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [226044] (42 PDB entries)

8. Domain d4pjbc1: 4pjb C:0-178 [263512]
   Other proteins in same PDB: d4pjba2, d4pjbb_, d4pjbc2, d4pjbd_, d4pjbe1, d4pjbe2, d4pjbf1, d4pjbf2, d4pjbg1, d4pjbg2, d4pjbh1, d4pjbh2
   automated match to d4l4vc1
   complexed with 2lj, gol

Details for d4pjbc1

PDB Entry: 4pjb, 2.85 Å

PDB Description: structure of human mr1-5-op-ru in complex with human mait b-f3-c1 tcr

PDB Compounds: (C:) Major histocompatibility complex class I-related gene protein

SCOPe Domain Sequences for d4pjbc1:

Sequence; same for both SEQRES and ATOM records:

>d4pjbc1 d.19.1.0 (C:0-178) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mrthslryfrlgvsdpihgvpefisvgyvdshpittydsvtrqkeprapwmaenlapdhw
erytqllrgwqqmfkvelkrlqrhynhsgshtyqrmigcelledgsttgflqyaydgqdf
lifnkdtlswlavdnvahtikqaweanqhellyqknwleeeciawlkrfleygkdtlqr

Timeline for d4pjbc1:

• d4pjbc1 is new in SCOPe 2.05-stable
  
• d4pjbc1 appears in SCOPe 2.06
  
• d4pjbc1 appears in the current release, SCOPe 2.08