Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.0: automated matches [227140] (1 protein) not a true family |
Protein automated matches [226842] (5 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [226044] (102 PDB entries) |
Domain d4pj9a1: 4pj9 A:1-178 [263510] Other proteins in same PDB: d4pj9a2, d4pj9a3, d4pj9b1, d4pj9b2, d4pj9c1, d4pj9c2, d4pj9d1, d4pj9d2 automated match to d4l4vc1 complexed with 2lj, gol, na |
PDB Entry: 4pj9 (more details), 2 Å
SCOPe Domain Sequences for d4pj9a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pj9a1 d.19.1.0 (A:1-178) automated matches {Human (Homo sapiens) [TaxId: 9606]} rthslryfrlgvsdpihgvpefisvgyvdshpittydsvtrqkeprapwmaenlapdhwe rytqllrgwqqmfkvelkrlqrhynhsgshtyqrmigcelledgsttgflqyaydgqdfl ifnkdtlswlavdnvahtikqaweanqhellyqknwleeeciawlkrfleygkdtlqr
Timeline for d4pj9a1: