Lineage for d1fujc_ (1fuj C:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1545310Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 1545311Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 1545555Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)
  6. 1546161Protein Myeloblastin, PR3 [50581] (1 species)
  7. 1546162Species Human (Homo sapiens) [TaxId:9606] [50582] (1 PDB entry)
  8. 1546165Domain d1fujc_: 1fuj C: [26351]

Details for d1fujc_

PDB Entry: 1fuj (more details), 2.2 Å

PDB Description: pr3 (myeloblastin)
PDB Compounds: (C:) pr3

SCOPe Domain Sequences for d1fujc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fujc_ b.47.1.2 (C:) Myeloblastin, PR3 {Human (Homo sapiens) [TaxId: 9606]}
ivggheaqphsrpymaslqmrgnpgshfcggtlihpsfvltaahclrdipqrlvnvvlga
hnvrtqeptqqhfsvaqvflnnydaenklndilliqlsspanlsasvatvqlpqqdqpvp
hgtqclamgwgrvgahdppaqvlqelnvtvvtffcrphnictfvprrkagicfgdsggpl
icdgiiqgidsfviwgcatrlfpdfftrvalyvdwirstlr

SCOPe Domain Coordinates for d1fujc_:

Click to download the PDB-style file with coordinates for d1fujc_.
(The format of our PDB-style files is described here.)

Timeline for d1fujc_: