Lineage for d4pj5a2 (4pj5 A:179-269)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1764871Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1764872Protein automated matches [190740] (26 species)
    not a true protein
  7. 1765207Species Human (Homo sapiens) [TaxId:9606] [187920] (558 PDB entries)
  8. 1765546Domain d4pj5a2: 4pj5 A:179-269 [263503]
    Other proteins in same PDB: d4pj5a1, d4pj5b_, d4pj5c1, d4pj5d2, d4pj5f_, d4pj5g2
    automated match to d4l4va2
    complexed with 30w

Details for d4pj5a2

PDB Entry: 4pj5 (more details), 2 Å

PDB Description: structure of human mr1-ac-6-fp in complex with human mait trbv6-1 tcr
PDB Compounds: (A:) Major histocompatibility complex class I-related gene protein

SCOPe Domain Sequences for d4pj5a2:

Sequence, based on SEQRES records: (download)

>d4pj5a2 b.1.1.0 (A:179-269) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tepplvrvnrketfpgvtalfckahgfyppeiymtwmkngeeivqeidygdilpsgdgty
qawasieldpqssnlyschvehsgvhmvlqv

Sequence, based on observed residues (ATOM records): (download)

>d4pj5a2 b.1.1.0 (A:179-269) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tepplvrvnrketfpgvtalfckahgfyppeiymtwmkngeeivqeidygdilpsgdgty
qawasiellyschvehsgvhmvlqv

SCOPe Domain Coordinates for d4pj5a2:

Click to download the PDB-style file with coordinates for d4pj5a2.
(The format of our PDB-style files is described here.)

Timeline for d4pj5a2: