Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (26 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187920] (558 PDB entries) |
Domain d4pj5a2: 4pj5 A:179-269 [263503] Other proteins in same PDB: d4pj5a1, d4pj5b_, d4pj5c1, d4pj5d2, d4pj5f_, d4pj5g2 automated match to d4l4va2 complexed with 30w |
PDB Entry: 4pj5 (more details), 2 Å
SCOPe Domain Sequences for d4pj5a2:
Sequence, based on SEQRES records: (download)
>d4pj5a2 b.1.1.0 (A:179-269) automated matches {Human (Homo sapiens) [TaxId: 9606]} tepplvrvnrketfpgvtalfckahgfyppeiymtwmkngeeivqeidygdilpsgdgty qawasieldpqssnlyschvehsgvhmvlqv
>d4pj5a2 b.1.1.0 (A:179-269) automated matches {Human (Homo sapiens) [TaxId: 9606]} tepplvrvnrketfpgvtalfckahgfyppeiymtwmkngeeivqeidygdilpsgdgty qawasiellyschvehsgvhmvlqv
Timeline for d4pj5a2: