Class b: All beta proteins [48724] (174 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins) |
Protein Myeloblastin, PR3 [50581] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [50582] (1 PDB entry) |
Domain d1fujb_: 1fuj B: [26350] |
PDB Entry: 1fuj (more details), 2.2 Å
SCOPe Domain Sequences for d1fujb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fujb_ b.47.1.2 (B:) Myeloblastin, PR3 {Human (Homo sapiens) [TaxId: 9606]} ivggheaqphsrpymaslqmrgnpgshfcggtlihpsfvltaahclrdipqrlvnvvlga hnvrtqeptqqhfsvaqvflnnydaenklndilliqlsspanlsasvatvqlpqqdqpvp hgtqclamgwgrvgahdppaqvlqelnvtvvtffcrphnictfvprrkagicfgdsggpl icdgiiqgidsfviwgcatrlfpdfftrvalyvdwirstlr
Timeline for d1fujb_: