Lineage for d4pijb_ (4pij B:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2177211Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2177212Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2177213Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 2178112Protein automated matches [190118] (12 species)
    not a true protein
  7. 2178143Species Human (Homo sapiens) [TaxId:9606] [189560] (94 PDB entries)
  8. 2178166Domain d4pijb_: 4pij B: [263497]
    automated match to d4pija_
    complexed with gol, so4; mutant

Details for d4pijb_

PDB Entry: 4pij (more details), 1.5 Å

PDB Description: x-ray crystal structure of the k11s/k63s double mutant of ubiquitin
PDB Compounds: (B:) Ubiquitin

SCOPe Domain Sequences for d4pijb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pijb_ d.15.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mqifvktltgstitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn
iqsestlhlvlrlrg

SCOPe Domain Coordinates for d4pijb_:

Click to download the PDB-style file with coordinates for d4pijb_.
(The format of our PDB-style files is described here.)

Timeline for d4pijb_: