![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
![]() | Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) ![]() |
![]() | Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins) |
![]() | Protein Activated protein c (autoprothrombin IIa) [50579] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [50580] (3 PDB entries) |
![]() | Domain d1autc_: 1aut C: [26348] Other proteins in same PDB: d1autl1, d1autl2 complexed with 0g6 |
PDB Entry: 1aut (more details), 2.8 Å
SCOPe Domain Sequences for d1autc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1autc_ b.47.1.2 (C:) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} lidgkmtrrgdspwqvvlldskkklacgavlihpswvltaahcmdeskkllvrlgeydlr rwekweldldikevfvhpnysksttdndiallhlaqpatlsqtivpiclpdsglaereln qagqetlvtgwgyhssrekeakrnrtfvlnfikipvvphnecsevmsnmvsenmlcagil gdrqdacegdsggpmvasfhgtwflvglvswgegcgllhnygvytkvsryldwihghird
Timeline for d1autc_: