Lineage for d1autc_ (1aut C:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 60334Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
  4. 60335Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 60420Family b.47.1.2: Eukaryotic proteases [50514] (35 proteins)
  6. 60482Protein Activated protein c (autoprothrombin IIa) [50579] (1 species)
  7. 60483Species Human (Homo sapiens) [TaxId:9606] [50580] (1 PDB entry)
  8. 60484Domain d1autc_: 1aut C: [26348]
    Other proteins in same PDB: d1autl1, d1autl2

Details for d1autc_

PDB Entry: 1aut (more details), 2.8 Å

PDB Description: Human activated protein C

SCOP Domain Sequences for d1autc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1autc_ b.47.1.2 (C:) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens)}
lidgkmtrrgdspwqvvlldskkklacgavlihpswvltaahcmdeskkllvrlgeydlr
rwekweldldikevfvhpnysksttdndiallhlaqpatlsqtivpiclpdsglaereln
qagqetlvtgwgyhssrekeakrnrtfvlnfikipvvphnecsevmsnmvsenmlcagil
gdrqdacegdsggpmvasfhgtwflvglvswgegcgllhnygvytkvsryldwihghird

SCOP Domain Coordinates for d1autc_:

Click to download the PDB-style file with coordinates for d1autc_.
(The format of our PDB-style files is described here.)

Timeline for d1autc_: