SCOPe 2.05: Domain d4pbvd1: 4pbv D:29-122

Lineage for d4pbvd1 (4pbv D:29-122)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (26 species)
   not a true protein

7. Species Chicken (Gallus gallus) [TaxId:9031] [188287] (18 PDB entries)

8. Domain d4pbvd1: 4pbv D:29-122 [263463]
   automated match to d2yd3a1
   complexed with nag, so4

Details for d4pbvd1

PDB Entry: 4pbv, 2.5 Å

PDB Description: crystal structure of chicken receptor protein tyrosine phosphatase sigma in complex with trkc

PDB Compounds: (D:) protein-tyrosine phosphatase crypalpha1 isoform

SCOPe Domain Sequences for d4pbvd1:

Sequence, based on SEQRES records:

>d4pbvd1 b.1.1.0 (D:29-122) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
esppvfikkpvdqigvsggvasfvcqatgdpkprvtwnkkgkkvnsqrfetiefdesaga
vlriqplrtprdeniyecvaqnphgevtvhaklt

Sequence, based on observed residues (ATOM records):

>d4pbvd1 b.1.1.0 (D:29-122) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
esppvfikkpvdqigvsggvasfvcqatgdpkprvtwnkkvnsqrfetiefdesagavlr
iqplrtprdeniyecvaqnphgevtvhaklt

Timeline for d4pbvd1:

• d4pbvd1 is new in SCOPe 2.05-stable
  
• d4pbvd1 appears in SCOPe 2.06
  
• d4pbvd1 appears in the current release, SCOPe 2.08