Lineage for d4pbvc2 (4pbv C:123-227)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1764871Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1764872Protein automated matches [190740] (26 species)
    not a true protein
  7. 1764875Species Chicken (Gallus gallus) [TaxId:9031] [188287] (18 PDB entries)
  8. 1764905Domain d4pbvc2: 4pbv C:123-227 [263462]
    automated match to d2yd3a2
    complexed with nag, so4

Details for d4pbvc2

PDB Entry: 4pbv (more details), 2.5 Å

PDB Description: crystal structure of chicken receptor protein tyrosine phosphatase sigma in complex with trkc
PDB Compounds: (C:) protein-tyrosine phosphatase crypalpha1 isoform

SCOPe Domain Sequences for d4pbvc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pbvc2 b.1.1.0 (C:123-227) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
vlredqlppgfpnidmgpqlkvvertrtatmlcaasgnpdpeitwfkdflpvdpstsngr
ikqlrsgglqiesseetdqgkyecvasnsagvrysspanlyvrvr

SCOPe Domain Coordinates for d4pbvc2:

Click to download the PDB-style file with coordinates for d4pbvc2.
(The format of our PDB-style files is described here.)

Timeline for d4pbvc2: