Lineage for d1kigh_ (1kig H:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2404157Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2404158Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2404432Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 2404778Protein Coagulation factor Xa, protease domain [50574] (2 species)
  7. 2404779Species Cow (Bos taurus) [TaxId:9913] [50576] (1 PDB entry)
  8. 2404780Domain d1kigh_: 1kig H: [26346]
    Other proteins in same PDB: d1kigi_, d1kigl_

Details for d1kigh_

PDB Entry: 1kig (more details), 3 Å

PDB Description: bovine factor xa
PDB Compounds: (H:) factor xa

SCOPe Domain Sequences for d1kigh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kigh_ b.47.1.2 (H:) Coagulation factor Xa, protease domain {Cow (Bos taurus) [TaxId: 9913]}
ivggrdcaegecpwqallvneenegfcggtilnefyvltaahclhqakrftvrvgdrnte
qeegnemahevemtvkhsrfvketydfdiavlrlktpirfrrnvapaclpekdwaeatlm
tqktgivsgfgrthekgrlsstlkmlevpyvdrstcklsssftitpnmfcagydtqpeda
cqgdsggphvtrfkdtyfvtgivswgegcarkgkfgvytkvsnflkwidkimkaragaag
s

SCOPe Domain Coordinates for d1kigh_:

Click to download the PDB-style file with coordinates for d1kigh_.
(The format of our PDB-style files is described here.)

Timeline for d1kigh_: