Class a: All alpha proteins [46456] (286 folds) |
Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.1: ARM repeat [48371] (26 families) |
Family a.118.1.0: automated matches [191340] (1 protein) not a true family |
Protein automated matches [190220] (12 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189070] (29 PDB entries) |
Domain d4p8qb4: 4p8q B:707-1025 [263459] Other proteins in same PDB: d4p8qa1, d4p8qa2, d4p8qa3, d4p8qb1, d4p8qb2, d4p8qb3 automated match to d4p8qa4 complexed with nag, unl, zn |
PDB Entry: 4p8q (more details), 3.02 Å
SCOPe Domain Sequences for d4p8qb4:
Sequence; same for both SEQRES and ATOM records: (download)
>d4p8qb4 a.118.1.0 (B:707-1025) automated matches {Human (Homo sapiens) [TaxId: 9606]} ddwealihqlkinpyvlsdkdranlinnifelaglgkvplkrafdlinylgnenhtapit ealfqtdliynlleklgymdlasrlvtrvfkllqnqiqqqtwtdegtpsmrelrsallef acthnlgncsttamklfddwmasngtqslptdvmttvfkvgaktdkgwsfllgkyisigs eaeknkilealassedvrklywlmksslngdnfrtqklsfiirtvgrhfpghllawdfvk enwnklvqkfplgsytiqnivagstylfstkthlsevqaffenqseatfrlrcvqealev iqlniqwmeknlksltwwl
Timeline for d4p8qb4:
View in 3D Domains from other chains: (mouse over for more information) d4p8qa1, d4p8qa2, d4p8qa3, d4p8qa4 |