SCOPe 2.03: Domain d1faxa_: 1fax A:

Lineage for d1faxa_ (1fax A:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)

6. Protein Coagulation factor Xa, protease domain [50574] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50575] (49 PDB entries)
   Uniprot P00742 235-467

8. Domain d1faxa_: 1fax A: [26345]
   Other proteins in same PDB: d1faxl_
   complexed with ca, dx9

Details for d1faxa_

PDB Entry: 1fax, 3 Å

PDB Description: coagulation factor xa inhibitor complex

PDB Compounds: (A:) factor xa

SCOPe Domain Sequences for d1faxa_:

Sequence; same for both SEQRES and ATOM records:

>d1faxa_ b.47.1.2 (A:) Coagulation factor Xa, protease domain {Human (Homo sapiens) [TaxId: 9606]}
ivggqeckdgecpwqallineenegfcggtilsefyiltaahclyqakrfkvrvgdrnta
aeeggeavhevevvikhnrftketydfdiavlrlktpitfrmnvapaclperdwaestlm
tqktgivsgfgrthekgrqstrlkmlevpyvdrnscklsssfiitqnmfcagydtkqeda
cqgdsggphvtrfkdtyfvtgivswgegcarkgkygiytkvtaflkwidrsmktr

Timeline for d1faxa_:

• d1faxa_ first appeared (with stable ids) in SCOP 1.55
  
• d1faxa_ appears in SCOPe 2.02
  
• d1faxa_ appears in SCOPe 2.04
  
• d1faxa_ appears in the current release, SCOPe 2.08