Class g: Small proteins [56992] (92 folds) |
Fold g.44: RING/U-box [57849] (1 superfamily) dimetal(zinc)-bound alpha+beta motif; structurally diverse |
Superfamily g.44.1: RING/U-box [57850] (7 families) |
Family g.44.1.1: RING finger domain, C3HC4 [57851] (15 proteins) |
Protein RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex [75693] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [75694] (9 PDB entries) Uniprot P62877 19-106 |
Domain d4p5od_: 4p5o D: [263438] Other proteins in same PDB: d4p5oa1, d4p5oa2, d4p5oc1, d4p5oc2, d4p5og_, d4p5oh_, d4p5oi_, d4p5ok_ automated match to d3dplr_ complexed with zn |
PDB Entry: 4p5o (more details), 3.11 Å
SCOPe Domain Sequences for d4p5od_:
Sequence, based on SEQRES records: (download)
>d4p5od_ g.44.1.1 (D:) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} evkkwnavalwawdivvdncaicrnhimdlciecqanqasatseectvawgvcnhafhfh cisrwlktrqvcpldnrewefqk
>d4p5od_ g.44.1.1 (D:) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} evkkwnavalwawdivvdncaicrnhimdlciecqanectvawgvcnhafhfhcisrwlk trqvcpldnrewefqk
Timeline for d4p5od_: