Class a: All alpha proteins [46456] (286 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.1: Ferritin [47241] (10 proteins) |
Protein automated matches [190041] (24 species) not a true protein |
Species Bullfrog (Rana catesbeiana) [TaxId:8400] [189485] (19 PDB entries) |
Domain d4p18m_: 4p18 M: [263397] automated match to d3shxa_ complexed with act, cl, edo, so4; mutant |
PDB Entry: 4p18 (more details), 1.91 Å
SCOPe Domain Sequences for d4p18m_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4p18m_ a.25.1.1 (M:) automated matches {Bullfrog (Rana catesbeiana) [TaxId: 8400]} vsqvrqnyhsdceaavnrmlnlelyasytyssmyaffdrddvalhnvaeffkehsheere haekfmkyqnkrggrvvlqkikkperdewgntleamqaalqlektvnqalldlhklatdk vdphlcdfleseyleeqvkdikrigdfitnlkrlglpengmgeylfdkhsvk
Timeline for d4p18m_: