Lineage for d4p18e_ (4p18 E:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2700839Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 2702255Protein automated matches [190041] (34 species)
    not a true protein
  7. 2702325Species Bullfrog (Rana catesbeiana) [TaxId:8400] [189485] (19 PDB entries)
  8. 2702368Domain d4p18e_: 4p18 E: [263389]
    automated match to d3shxa_
    complexed with act, cl, edo, so4; mutant

Details for d4p18e_

PDB Entry: 4p18 (more details), 1.91 Å

PDB Description: crystal structure of frog m ferritin mutant d80k
PDB Compounds: (E:) Ferritin, middle subunit

SCOPe Domain Sequences for d4p18e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4p18e_ a.25.1.1 (E:) automated matches {Bullfrog (Rana catesbeiana) [TaxId: 8400]}
vsqvrqnyhsdceaavnrmlnlelyasytyssmyaffdrddvalhnvaeffkehsheere
haekfmkyqnkrggrvvlqkikkperdewgntleamqaalqlektvnqalldlhklatdk
vdphlcdfleseyleeqvkdikrigdfitnlkrlglpengmgeylfdkhsvk

SCOPe Domain Coordinates for d4p18e_:

Click to download the PDB-style file with coordinates for d4p18e_.
(The format of our PDB-style files is described here.)

Timeline for d4p18e_: