SCOPe 2.05: Domain d4ozhc1: 4ozh C:1-81

Lineage for d4ozhc1 (4ozh C:1-81)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.0: automated matches [227140] (1 protein)
   not a true family

6. Protein automated matches [226842] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [226044] (42 PDB entries)

8. Domain d4ozhc1: 4ozh C:1-81 [263382]
   Other proteins in same PDB: d4ozha2, d4ozhb2, d4ozhc2, d4ozhd2, d4ozhe1, d4ozhe2, d4ozhf1, d4ozhf2, d4ozhg1, d4ozhg2, d4ozhh1, d4ozhh2
   automated match to d4ozfa1
   complexed with ca, nag

Details for d4ozhc1

PDB Entry: 4ozh, 2.8 Å

PDB Description: s16 protein complex

PDB Compounds: (C:) HLA class II histocompatibility antigen, DQ alpha 1 chain

SCOPe Domain Sequences for d4ozhc1:

Sequence; same for both SEQRES and ATOM records:

>d4ozhc1 d.19.1.0 (C:1-81) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ivadhvasygvnlyqsygpsgqythefdgdeqfyvdlgrketvwclpvlrqfrfdpqfal
tniavlkhnlnslikrsnsta

Timeline for d4ozhc1:

• d4ozhc1 is new in SCOPe 2.05-stable
  
• d4ozhc1 appears in SCOPe 2.06
  
• d4ozhc1 appears in the current release, SCOPe 2.08