Lineage for d4oryh_ (4ory H:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2804246Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2804247Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2805574Family b.60.1.0: automated matches [191454] (1 protein)
    not a true family
  6. 2805575Protein automated matches [190698] (25 species)
    not a true protein
  7. 2805614Species Human (Homo sapiens) [TaxId:9606] [187833] (51 PDB entries)
  8. 2805656Domain d4oryh_: 4ory H: [263341]
    automated match to d2k23a_
    complexed with peu; mutant

Details for d4oryh_

PDB Entry: 4ory (more details), 1.8 Å

PDB Description: Three-dimensional structure of the C65A-K59A double mutant of Human lipocalin-type Prostaglandin D Synthase holo, second crystal form
PDB Compounds: (H:) Prostaglandin-H2 D-isomerase

SCOPe Domain Sequences for d4oryh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4oryh_ b.60.1.0 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
svqpnfqqdkflgrwfsaglasnsswlrekaaalsmaksvvapatdgglnltstflrknq
cetrtmllqpagslgsysyrsphwgstysvsvvetdydqyallysqgskgpgedfrmatl
ysrtqtpraelkekftafckaqgftedtivflpqtdkc

SCOPe Domain Coordinates for d4oryh_:

Click to download the PDB-style file with coordinates for d4oryh_.
(The format of our PDB-style files is described here.)

Timeline for d4oryh_: