Lineage for d1bdab_ (1bda B:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1318222Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 1318223Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 1318445Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)
  6. 1319084Protein Single chain tissue plasminogen activator [50567] (2 species)
  7. 1319085Species Human (Homo sapiens) [TaxId:9606] [50568] (1 PDB entry)
  8. 1319087Domain d1bdab_: 1bda B: [26330]
    complexed with 2z0

Details for d1bdab_

PDB Entry: 1bda (more details), 3.35 Å

PDB Description: catalytic domain of human single chain tissue plasminogen activator in complex with dansyl-egr-cmk (dansyl-glu-gly-arg chloromethyl ketone)
PDB Compounds: (B:) single chain tissue type plasminogen activator

SCOPe Domain Sequences for d1bdab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bdab_ b.47.1.2 (B:) Single chain tissue plasminogen activator {Human (Homo sapiens) [TaxId: 9606]}
tcglrqysqpqfrikgglfadiashpwqaaifakhrrspgerflcggilisscwilsaah
cfqerfpphhltvilgrtyrvvpgeeeqkfevekyivhkefdddtydndiallqlksdss
rcaqessvvrtvclppadlqlpdwtecelsgygkhealspfyserlkeahvrlypssrct
sqhllnrtvtdnmlcagdtrsggpqanlhdacqgdsggplvclndgrmtlvgiiswglgc
gqkdvpgvytkvtnyldwirdnmrp

SCOPe Domain Coordinates for d1bdab_:

Click to download the PDB-style file with coordinates for d1bdab_.
(The format of our PDB-style files is described here.)

Timeline for d1bdab_: