SCOPe 2.08: Domain d4oftb1: 4oft B:1-77

Lineage for d4oftb1 (4oft B:1-77)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (195 species)
   not a true protein

7. Species Necator americanus [TaxId:51031] [224893] (6 PDB entries)

8. Domain d4oftb1: 4oft B:1-77 [263282]
   Other proteins in same PDB: d4ofta2, d4oftb2
   automated match to d2on7a1

Details for d4oftb1

PDB Entry: 4oft, 2.6 Å

PDB Description: c- orthorombic nagst1

PDB Compounds: (B:) Glutathione S-transferase-1

SCOPe Domain Sequences for d4oftb1:

Sequence; same for both SEQRES and ATOM records:

>d4oftb1 c.47.1.0 (B:1-77) automated matches {Necator americanus [TaxId: 51031]}
mvhykltyfairgagecarqifaladqefedvrldkeqfakvkpdlpfgqvpvlevdgkq
laqslaicrylarqfgf

Timeline for d4oftb1:

• d4oftb1 first appeared in SCOPe 2.05
  
• d4oftb1 appears in SCOPe 2.07