SCOPe 2.06: Domain d4ocnd_: 4ocn D:

Lineage for d4ocnd_ (4ocn D:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
   core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest

4. Superfamily c.97.3: JAB1/MPN domain [102712] (2 families)

5. Family c.97.3.0: automated matches [267623] (1 protein)
   not a true family

6. Protein automated matches [267670] (3 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [267950] (10 PDB entries)

8. Domain d4ocnd_: 4ocn D: [263276]
   Other proteins in same PDB: d4ocnc_, d4ocnf_
   automated match to d2o95a_

Details for d4ocnd_

PDB Entry: 4ocn, 2.25 Å

PDB Description: crystal structure of the rpn8-rpn11 mpn domain heterodimer, crystal form ii

PDB Compounds: (D:) 26s proteasome regulatory subunit rpn8

SCOPe Domain Sequences for d4ocnd_:

Sequence; same for both SEQRES and ATOM records:

>d4ocnd_ c.97.3.0 (D:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
hekvtiaplvllsaldhyertqtkenkrcvgvilgdansstirvtnsfalpfeedeknsd
vwfldhnyienmnemckkinakekligwyhsgpklrasdlkinelfkkytqnnplllivd
vkqqgvglptdayvaieqvkddgtstektflhlpctieaeeaeeigvehllr

Timeline for d4ocnd_:

• d4ocnd_ first appeared in SCOPe 2.05
  
• d4ocnd_ appears in SCOPe 2.07
  
• d4ocnd_ appears in the current release, SCOPe 2.08