Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies) core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest |
Superfamily c.97.3: JAB1/MPN domain [102712] (2 families) |
Family c.97.3.0: automated matches [267623] (1 protein) not a true family |
Protein automated matches [267670] (3 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [267950] (10 PDB entries) |
Domain d4ocnd_: 4ocn D: [263276] Other proteins in same PDB: d4ocnc_, d4ocnf_ automated match to d2o95a_ |
PDB Entry: 4ocn (more details), 2.25 Å
SCOPe Domain Sequences for d4ocnd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ocnd_ c.97.3.0 (D:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} hekvtiaplvllsaldhyertqtkenkrcvgvilgdansstirvtnsfalpfeedeknsd vwfldhnyienmnemckkinakekligwyhsgpklrasdlkinelfkkytqnnplllivd vkqqgvglptdayvaieqvkddgtstektflhlpctieaeeaeeigvehllr
Timeline for d4ocnd_: