SCOPe 2.05: Domain d4ocla_: 4ocl A:

Lineage for d4ocla_ (4ocl A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
   core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest

4. Superfamily c.97.3: JAB1/MPN domain [102712] (2 families)

5. Family c.97.3.0: automated matches [267623] (1 protein)
   not a true family

6. Protein automated matches [267670] (3 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [267950] (8 PDB entries)

8. Domain d4ocla_: 4ocl A: [263271]
   Other proteins in same PDB: d4oclc_, d4oclf_
   automated match to d2o95a_
   complexed with zn

Details for d4ocla_

PDB Entry: 4ocl, 2.4 Å

PDB Description: Crystal Structure of the Rpn8-Rpn11 MPN domain heterodimer, crystal form Ia

PDB Compounds: (A:) 26s proteasome regulatory subunit rpn8

SCOPe Domain Sequences for d4ocla_:

Sequence, based on SEQRES records:

>d4ocla_ c.97.3.0 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
hekvtiaplvllsaldhyertqtkenkrcvgvilgdansstirvtnsfalpfeedeknsd
vwfldhnyienmnemckkinakekligwyhsgpklrasdlkinelfkkytqnnplllivd
vkqqgvglptdayvaieqvkddgtstektflhlpctieaeeaeeigvehllr

Sequence, based on observed residues (ATOM records):

>d4ocla_ c.97.3.0 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
hekvtiaplvllsaldhyertqtkenkrcvgvilgdansstirvtnsfalpfeedeknsd
vwfldhnyienmnemckkinakekligwyhsgpklrasdlkinelfkkytqnnplllivd
vkqqgvglptdayvaieqktflhlpctieaeeaeeigvehllr

Timeline for d4ocla_:

• d4ocla_ is new in SCOPe 2.05-stable
  
• d4ocla_ appears in SCOPe 2.06
  
• d4ocla_ appears in the current release, SCOPe 2.08