SCOPe 2.05: Domain d4ob0b_: 4ob0 B:

Lineage for d4ob0b_ (4ob0 B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.4: Electron transport accessory proteins [50090] (5 families)

5. Family b.34.4.4: Nitrile hydratase beta chain [50101] (3 proteins)
   contains irregular array of helices in the N-terminal extension
   automatically mapped to Pfam PF02211

6. Protein automated matches [190606] (3 species)
   not a true protein

7. Species Pseudonocardia thermophila [TaxId:1848] [229020] (5 PDB entries)

8. Domain d4ob0b_: 4ob0 B: [263266]
   Other proteins in same PDB: d4ob0a_
   automated match to d4ob3b_
   complexed with co, pbc

Details for d4ob0b_

PDB Entry: 4ob0, 1.2 Å

PDB Description: crystal structure of nitrile hydratase from pseudonocardia thermophila bound to phenyl boronic acid

PDB Compounds: (B:) Cobalt-containing nitrile hydratase subunit beta

SCOPe Domain Sequences for d4ob0b_:

Sequence; same for both SEQRES and ATOM records:

>d4ob0b_ b.34.4.4 (B:) automated matches {Pseudonocardia thermophila [TaxId: 1848]}
mngvydvggtdglgpinrpadepvfraewekvafamfpatfragfmgldefrfgieqmnp
aeylespyywhwirtyihhgvrtgkidleelerrtqyyrenpdaplpeheqkpeliefvn
qavygglpasrevdrppkfkegdvvrfstaspkgharraryvrgktgtvvkhhgayiypd
tagnglgecpehlytvrftaqelwgpegdpnssvyydcwepyielvdt

Timeline for d4ob0b_:

• d4ob0b_ is new in SCOPe 2.05-stable
  
• d4ob0b_ appears in SCOPe 2.06
  
• d4ob0b_ appears in the current release, SCOPe 2.08