Lineage for d4o1qe_ (4o1q E:)
- Root: SCOPe 2.08
Class g: Small proteins [56992] (100 folds) 
Fold g.21: Methylamine dehydrogenase, L chain [57560] (1 superfamily)
disulfide-rich; nearly all-betaSuperfamily g.21.1: Methylamine dehydrogenase, L chain [57561] (2 families) 
Family g.21.1.1: Methylamine dehydrogenase, L chain [57562] (2 proteins)
automatically mapped to Pfam PF02975
Protein automated matches [190303] (3 species)
not a true protein
Species Paracoccus denitrificans [TaxId:266] [187112] (6 PDB entries) 
Domain d4o1qe_: 4o1q E: [263245]
automated match to d4fa9e_
complexed with ca, edo, hec, mes, na, pge, po4
Details for d4o1qe_
PDB Entry: 4o1q (more details), 2.59 Å
PDB Description: Crystal Structure of the Q103N-MauG/pre-Methylamine Dehydrogenase Complex
PDB Compounds: (E:) Methylamine dehydrogenase light chainSCOPe Domain Sequences for d4o1qe_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4o1qe_ g.21.1.1 (E:) automated matches {Paracoccus denitrificans [TaxId: 266]}
tdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvascynptd
gqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyhctispi
vgkas
SCOPe Domain Coordinates for d4o1qe_:
Click to download the PDB-style file with coordinates for d4o1qe_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4o1qe_:
- d4o1qe_ first appeared in SCOPe 2.05
- d4o1qe_ appears in SCOPe 2.07
View in 3D
