SCOPe 2.05: Domain d4nyld1: 4nyl D:1-106

Lineage for d4nyld1 (4nyl D:1-106)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (26 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (558 PDB entries)

8. Domain d4nyld1: 4nyl D:1-106 [263236]
   Other proteins in same PDB: d4nyld2, d4nyll2
   automated match to d1dn0a1

Details for d4nyld1

PDB Entry: 4nyl, 2.8 Å

PDB Description: Crystal structure of adalimumab FAB fragment

PDB Compounds: (D:) Adalimumab Light Chain

SCOPe Domain Sequences for d4nyld1:

Sequence; same for both SEQRES and ATOM records:

>d4nyld1 b.1.1.0 (D:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diqmtqspsslsasvgdrvtitcrasqgirnylawyqqkpgkapklliyaastlqsgvps
rfsgsgsgtdftltisslqpedvatyycqrynrapytfgqgtkvei

Timeline for d4nyld1:

• d4nyld1 is new in SCOPe 2.05-stable
  
• d4nyld1 appears in SCOPe 2.06
  
• d4nyld1 appears in the current release, SCOPe 2.08