Lineage for d4nstc_ (4nst C:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1929110Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1929111Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1932524Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. 1932525Protein automated matches [190417] (21 species)
    not a true protein
  7. 1932655Species Human (Homo sapiens) [TaxId:9606] [187294] (615 PDB entries)
  8. 1933163Domain d4nstc_: 4nst C: [263221]
    Other proteins in same PDB: d4nstb1, d4nstb2, d4nstd1, d4nstd2
    automated match to d4un0c_
    protein/RNA complex; complexed with adp, af3, edo, mg

Details for d4nstc_

PDB Entry: 4nst (more details), 2.2 Å

PDB Description: Crystal structure of human Cdk12/Cyclin K in complex with ADP-aluminum fluoride
PDB Compounds: (C:) cyclin-dependent kinase 12

SCOPe Domain Sequences for d4nstc_:

Sequence, based on SEQRES records: (download)

>d4nstc_ d.144.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sdwgkrcvdkfdiigiigegtygqvykakdkdtgelvalkkvrldnekegfpitaireik
ilrqlihrsvvnmkeivtdkqdaldfkkdkgafylvfeymdhdlmgllesglvhfsedhi
ksfmkqlmegleychkknflhrdikcsnillnnsgqikladfglarlynseesrpytnkv
itlwyrppelllgeerytpaidvwscgcilgelftkkpifqanlelaqlelisrlcgspc
pavwpdviklpyfntmkpkkqyrrrlreefsfipsaaldlldhmltldpskrctaeqtlq
sdflkdvelskmappdlphwqdchelwsk

Sequence, based on observed residues (ATOM records): (download)

>d4nstc_ d.144.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sdwgkrcvdkfdiigiigegtygqvykakdkdtgelvalkkvrldnekegfpitaireik
ilrqlihrsvvnmkeivtdkgafylvfeymdhdlmgllesglvhfsedhiksfmkqlmeg
leychkknflhrdikcsnillnnsgqikladfglarlynsesrpytnkvitlwyrppell
lgeerytpaidvwscgcilgelftkkpifqanlelaqlelisrlcgspcpavwpdviklp
yfntmkpkkqyrrrlreefsfipsaaldlldhmltldpskrctaeqtlqsdflkdvelsk
mappdlphwqdchelwsk

SCOPe Domain Coordinates for d4nstc_:

Click to download the PDB-style file with coordinates for d4nstc_.
(The format of our PDB-style files is described here.)

Timeline for d4nstc_: