SCOPe 2.05: Domain d4nqde1: 4nqd E:2-116

Lineage for d4nqde1 (4nqd E:2-116)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (26 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (558 PDB entries)

8. Domain d4nqde1: 4nqd E:2-116 [263191]
   Other proteins in same PDB: d4nqda1, d4nqdb_, d4nqdc1, d4nqdf_, d4nqdg2
   automated match to d2axha1
   complexed with 2lj, gol

Details for d4nqde1

PDB Entry: 4nqd, 2.2 Å

PDB Description: Crystal structure of TCR-MR1 ternary complex and non-covalently bound 5-(2-oxopropylideneamino)-6-D-ribitylaminouracil

PDB Compounds: (E:) TCR beta chain

SCOPe Domain Sequences for d4nqde1:

Sequence; same for both SEQRES and ATOM records:

>d4nqde1 b.1.1.0 (E:2-116) automated matches {Human (Homo sapiens) [TaxId: 9606]}
agvtqtpkfqvlktgqsmtlqcaqdmnhnsmywyrqdpgmglrliyysasegttdkgevp
ngynvsrlnkrefslrlesaapsqtsvyfcassvwtgegsgelffgegsrltvle

Timeline for d4nqde1:

• d4nqde1 is new in SCOPe 2.05-stable
  
• d4nqde1 appears in SCOPe 2.06
  
• d4nqde1 appears in the current release, SCOPe 2.08