SCOPe 2.08: Domain d4nqcg2: 4nqc G:111-199

Lineage for d4nqcg2 (4nqc G:111-199)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d4nqcg2: 4nqc G:111-199 [263185]
   Other proteins in same PDB: d4nqca1, d4nqca2, d4nqca3, d4nqcb_, d4nqcc1, d4nqcc2, d4nqcc3, d4nqcd1, d4nqce1, d4nqce2, d4nqcf_, d4nqcg1, d4nqch1, d4nqch2
   automated match to d2f54d2
   complexed with 2lj, na

Details for d4nqcg2

PDB Entry: 4nqc, 2.5 Å

PDB Description: Crystal structure of TCR-MR1 ternary complex and covalently bound 5-(2-oxopropylideneamino)-6-D-ribitylaminouracil

PDB Compounds: (G:) TcR alpha chain

SCOPe Domain Sequences for d4nqcg2:

Sequence; same for both SEQRES and ATOM records:

>d4nqcg2 b.1.1.2 (G:111-199) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffps

Timeline for d4nqcg2:

• d4nqcg2 first appeared in SCOPe 2.05
  
• d4nqcg2 appears in SCOPe 2.07