Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (15 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries) |
Domain d4nqcg2: 4nqc G:111-199 [263185] Other proteins in same PDB: d4nqca1, d4nqca2, d4nqca3, d4nqcb_, d4nqcc1, d4nqcc2, d4nqcc3, d4nqcd1, d4nqce1, d4nqce2, d4nqcf_, d4nqcg1, d4nqch1, d4nqch2 automated match to d2f54d2 complexed with 2lj, na |
PDB Entry: 4nqc (more details), 2.5 Å
SCOPe Domain Sequences for d4nqcg2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4nqcg2 b.1.1.2 (G:111-199) automated matches {Human (Homo sapiens) [TaxId: 9606]} iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns avawsnksdfacanafnnsiipedtffps
Timeline for d4nqcg2: