SCOPe 2.05: Domain d4nqcc2: 4nqc C:179-269

Lineage for d4nqcc2 (4nqc C:179-269)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (26 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (558 PDB entries)

8. Domain d4nqcc2: 4nqc C:179-269 [263183]
   Other proteins in same PDB: d4nqca1, d4nqcb_, d4nqcc1, d4nqcd2, d4nqcf_, d4nqcg2
   automated match to d4l4va2
   complexed with 2lj, na

Details for d4nqcc2

PDB Entry: 4nqc, 2.5 Å

PDB Description: Crystal structure of TCR-MR1 ternary complex and covalently bound 5-(2-oxopropylideneamino)-6-D-ribitylaminouracil

PDB Compounds: (C:) Major histocompatibility complex class I-related gene protein

SCOPe Domain Sequences for d4nqcc2:

Sequence, based on SEQRES records:

>d4nqcc2 b.1.1.0 (C:179-269) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tepplvrvnrketfpgvtalfckahgfyppeiymtwmkngeeivqeidygdilpsgdgty
qawasieldpqssnlyschvehsgvhmvlqv

Sequence, based on observed residues (ATOM records):

>d4nqcc2 b.1.1.0 (C:179-269) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tepplvrvnrketfpgvtalfckahgfyppeiymtwmkngeeivqeidygdilpsgdgty
qawasielnlyschvehsgvhmvlqv

Timeline for d4nqcc2:

• d4nqcc2 is new in SCOPe 2.05-stable
  
• d4nqcc2 appears in SCOPe 2.06
  
• d4nqcc2 appears in the current release, SCOPe 2.08