SCOPe 2.05: Domain d4nqcc1: 4nqc C:0-178

Lineage for d4nqcc1 (4nqc C:0-178)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.0: automated matches [227140] (1 protein)
   not a true family

6. Protein automated matches [226842] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [226044] (42 PDB entries)

8. Domain d4nqcc1: 4nqc C:0-178 [263182]
   Other proteins in same PDB: d4nqca2, d4nqcb_, d4nqcc2, d4nqcd1, d4nqcd2, d4nqce1, d4nqce2, d4nqcf_, d4nqcg1, d4nqcg2, d4nqch1, d4nqch2
   automated match to d4l4vc1
   complexed with 2lj, na

Details for d4nqcc1

PDB Entry: 4nqc, 2.5 Å

PDB Description: Crystal structure of TCR-MR1 ternary complex and covalently bound 5-(2-oxopropylideneamino)-6-D-ribitylaminouracil

PDB Compounds: (C:) Major histocompatibility complex class I-related gene protein

SCOPe Domain Sequences for d4nqcc1:

Sequence, based on SEQRES records:

>d4nqcc1 d.19.1.0 (C:0-178) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mrthslryfrlgvsdpihgvpefisvgyvdshpittydsvtrqkeprapwmaenlapdhw
erytqllrgwqqmfkvelkrlqrhynhsgshtyqrmigcelledgsttgflqyaydgqdf
lifnkdtlswlavdnvahtikqaweanqhellyqknwleeeciawlkrfleygkdtlqr

Sequence, based on observed residues (ATOM records):

>d4nqcc1 d.19.1.0 (C:0-178) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mrthslryfrlgvsdpivpefisvgyvdshpittydsvtrqkeprapwmaenlapdhwer
ytqllrgwqqmfkvelkrlqrhynhsgshtyqrmigcelledgsttgflqyaydgqdfli
fnkdtlswlavdnvahtikqaweanqhellyqknwleeeciawlkrfleygkdtlqr

Timeline for d4nqcc1:

• d4nqcc1 is new in SCOPe 2.05-stable
  
• d4nqcc1 appears in SCOPe 2.06
  
• d4nqcc1 appears in the current release, SCOPe 2.08