Lineage for d4noyc_ (4noy C:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2380450Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 2380451Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) (S)
  5. 2381067Family b.38.1.0: automated matches [191538] (1 protein)
    not a true family
  6. 2381068Protein automated matches [190914] (14 species)
    not a true protein
  7. 2381192Species Listeria monocytogenes [TaxId:1639] [259405] (3 PDB entries)
  8. 2381201Domain d4noyc_: 4noy C: [263178]
    automated match to d4noya_
    complexed with pgo

Details for d4noyc_

PDB Entry: 4noy (more details), 2.8 Å

PDB Description: crystal structure of listeria monocytogenes hfq f43w
PDB Compounds: (C:) Protein hfq

SCOPe Domain Sequences for d4noyc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4noyc_ b.38.1.0 (C:) automated matches {Listeria monocytogenes [TaxId: 1639]}
kqggqglqdyylnqlrkekilatvfltngfqlrgrvvsfdnwtvlldvegkqqlvfkhai
stfspqknvalnp

SCOPe Domain Coordinates for d4noyc_:

Click to download the PDB-style file with coordinates for d4noyc_.
(The format of our PDB-style files is described here.)

Timeline for d4noyc_: