Lineage for d4nkre1 (4nkr E:11-174)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2871581Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2871582Protein automated matches [190123] (158 species)
    not a true protein
  7. 2871672Species Bacillus subtilis [TaxId:655816] [261215] (2 PDB entries)
  8. 2871677Domain d4nkre1: 4nkr E:11-174 [263153]
    Other proteins in same PDB: d4nkra2, d4nkrb2, d4nkrc2, d4nkrd2, d4nkre2
    automated match to d4nkra_
    complexed with so4

Details for d4nkre1

PDB Entry: 4nkr (more details), 2.41 Å

PDB Description: the crystal structure of bacillus subtilis mobb
PDB Compounds: (E:) Molybdopterin-guanine dinucleotide biosynthesis protein B

SCOPe Domain Sequences for d4nkre1:

Sequence, based on SEQRES records: (download)

>d4nkre1 c.37.1.0 (E:11-174) automated matches {Bacillus subtilis [TaxId: 655816]}
pivqvvgfqnsgkttfierilekaseqglnlgclkhhghggepqtftegkdtdryqaaga
dvtavegagvlqltarrlwdltrlielyqfletdclliegfkkapypkvvilsekedlea
lktvntiaiiyrkkehmtehqglpifhaddpvavdlvlsqlkge

Sequence, based on observed residues (ATOM records): (download)

>d4nkre1 c.37.1.0 (E:11-174) automated matches {Bacillus subtilis [TaxId: 655816]}
pivqvvgfqnsgkttfierilekaseqglnlgclkhhghggepqtftegkdryqaagadv
tavegagvlqltarrlwdltrlielyqfletdclliegfkkapypkvvilsekedlealk
tvntiaiiyrkkehmtehqglpifhaddpvavdlvlsqlkge

SCOPe Domain Coordinates for d4nkre1:

Click to download the PDB-style file with coordinates for d4nkre1.
(The format of our PDB-style files is described here.)

Timeline for d4nkre1: