Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.5: Inosine monophosphate dehydrogenase (IMPDH) [51412] (2 families) The phosphate moiety of substrate binds in the 'common' phosphate-binding site |
Family c.1.5.0: automated matches [227276] (1 protein) not a true family |
Protein automated matches [227084] (16 species) not a true protein |
Species Bacillus anthracis [TaxId:198094] [228249] (8 PDB entries) |
Domain d4myxc1: 4myx C:1-486 [263070] Other proteins in same PDB: d4myxa2, d4myxb2, d4myxc2, d4myxd2, d4myxe2, d4myxf2, d4myxg2, d4myxh2 automated match to d4qm1b_ complexed with 2f0, edo, fmt, gol, imp, mli, so4 |
PDB Entry: 4myx (more details), 2.7 Å
SCOPe Domain Sequences for d4myxc1:
Sequence, based on SEQRES records: (download)
>d4myxc1 c.1.5.0 (C:1-486) automated matches {Bacillus anthracis [TaxId: 198094]} mweskfvkegltfddvllvpaksdvlprevsvktvlseslqlniplisagmdtvteadma iamarqgglgiihknmsieqqaeqvdkvkrsggllvgaavgvtadamtridalvkasvda ivldtahghsqgvidkvkevrakypslniiagnvataeatkalieaganvvkvgigpgsi cttrvvagvgvpqltavydcatearkhgipviadggikysgdmvkalaagahvvmlgsmf agvaespgeteiyqgrqfkvyrgmgsvgamekgskdryfqegnkklvpegiegrvpykgp ladtvhqlvgglragmgycgaqdleflrenaqfirmsgaglleshphhvqitkeapnys
>d4myxc1 c.1.5.0 (C:1-486) automated matches {Bacillus anthracis [TaxId: 198094]} mweskfvkegltfddvllvpaksdvlprevsvktvlseslqlniplisagmdtvteadma iamarqgglgiihknmsieqqaeqvdkvkrsggllvgaavgvtadamtridalvkasvda ivldtahghsqgvidkvkevrakypslniiagnvataeatkalieaganvvkvgigpgsi cttrvvagvgvpqltavydcatearkhgipviadggikysgdmvkalaagahvvmlgsmf agvaespgeteiyqgrqfkvyrgmgsvgameklvpegiegrvpykgpladtvhqlvgglr agmgycgaqdleflrenaqfirmsgaglleshphhvqitkeapnys
Timeline for d4myxc1: