Class b: All beta proteins [48724] (174 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins) |
Protein Tonin [50557] (1 species) |
Species Rat (Rattus rattus) [TaxId:10117] [50558] (1 PDB entry) |
Domain d1tona_: 1ton A: [26307] complexed with zn |
PDB Entry: 1ton (more details), 1.8 Å
SCOPe Domain Sequences for d1tona_:
Sequence, based on SEQRES records: (download)
>d1tona_ b.47.1.2 (A:) Tonin {Rat (Rattus rattus) [TaxId: 10117]} ivggykceknsqpwqvavineylcggvlidpswvitaahcysnnyqvllgrnnlfkdepf aqrrlvrqsfrhpdyiplivtndteqpvhdhsndlmllhlsepaditggvkvidlptkep kvgstclasgwgstnpsemvvshdlqcvnihllsnekcietykdnvtdvmlcagemeggk dtcagdsggplicdgvlqgitsggatpcakpktpaiyaklikftswikkvmkenp
>d1tona_ b.47.1.2 (A:) Tonin {Rat (Rattus rattus) [TaxId: 10117]} ivggykceknsqpwqvavineylcggvlidpswvitaahcysnnyqvllgrnnlfkdepf aqrrlvrqsfrhpdyiplipvhdhsndlmllhlsepaditggvkvidlptkepkvgstcl asgwgstnpsemvvshdlqcvnihllsnekcietykdnvtdvmlcagemeggkdtcagds ggplicdgvlqgitsggatpcakpktpaiyaklikftswikkvmkenp
Timeline for d1tona_: