Lineage for d4my6a_ (4my6 A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1798838Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 1798839Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 1799421Family b.55.1.0: automated matches [191311] (1 protein)
    not a true family
  6. 1799422Protein automated matches [190052] (5 species)
    not a true protein
  7. 1799448Species Human (Homo sapiens) [TaxId:9606] [186914] (36 PDB entries)
  8. 1799451Domain d4my6a_: 4my6 A: [263067]
    automated match to d2jp2a_
    complexed with 3vh, br

Details for d4my6a_

PDB Entry: 4my6 (more details), 1.7 Å

PDB Description: enah-evh1 in complex with peptidomimetic low-molecular weight inhibitor ac-[2-cl-f]-[prom-2]-[prom-1]-oh
PDB Compounds: (A:) Protein enabled homolog

SCOPe Domain Sequences for d4my6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4my6a_ b.55.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
seqsicqaraavmvyddankkwvpaggstgfsrvhiyhhtgnntfrvvgrkiqdhqvvin
caipkglkynqatqtfhqwrdarqvyglnfgskedanvfasammhalevl

SCOPe Domain Coordinates for d4my6a_:

Click to download the PDB-style file with coordinates for d4my6a_.
(The format of our PDB-style files is described here.)

Timeline for d4my6a_: