SCOPe 2.06: Domain d4mxgb_: 4mxg B:

Lineage for d4mxgb_ (4mxg B:)

1. Root: SCOPe 2.06

2. Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.0: automated matches [191512] (1 protein)
   not a true family

6. Protein automated matches [190857] (40 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:287] [189201] (28 PDB entries)

8. Domain d4mxgb_: 4mxg B: [263060]
   automated match to d4mxga_
   complexed with cl, flc, mpd

Details for d4mxgb_

PDB Entry: 4mxg, 1.48 Å

PDB Description: crystal structure of extended-spectrum beta-lactamase bel-1 (monoclinic form)

PDB Compounds: (B:) bel-1

SCOPe Domain Sequences for d4mxgb_:

Sequence; same for both SEQRES and ATOM records:

>d4mxgb_ e.3.1.0 (B:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
dfehaisdleahnqakigvalvsengnliqgyranerfamcstfklplaalvlsridage
enperklhydsafleeyapaakryvatgymtvteaiqsalqlsdnaaanlllkevggppl
ltkyfrslgdkvsrldrieptlntntpgderdtttpmsmaqtvsklifgdtltykskgql
rrllignqtgdktiraglpdswvtgdktgscanggrndvaffittagkkyvlsvytnape
lqgeeralliasvaklarqyvvh

Timeline for d4mxgb_:

• d4mxgb_ first appeared in SCOPe 2.05
  
• d4mxgb_ does not appear in SCOPe 2.07