Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds) |
Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily) contains a cluster of helices and an alpha+beta sandwich |
Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) |
Family e.3.1.0: automated matches [191512] (1 protein) not a true family |
Protein automated matches [190857] (40 species) not a true protein |
Species Pseudomonas aeruginosa [TaxId:287] [189201] (28 PDB entries) |
Domain d4mxgb_: 4mxg B: [263060] automated match to d4mxga_ complexed with cl, flc, mpd |
PDB Entry: 4mxg (more details), 1.48 Å
SCOPe Domain Sequences for d4mxgb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4mxgb_ e.3.1.0 (B:) automated matches {Pseudomonas aeruginosa [TaxId: 287]} dfehaisdleahnqakigvalvsengnliqgyranerfamcstfklplaalvlsridage enperklhydsafleeyapaakryvatgymtvteaiqsalqlsdnaaanlllkevggppl ltkyfrslgdkvsrldrieptlntntpgderdtttpmsmaqtvsklifgdtltykskgql rrllignqtgdktiraglpdswvtgdktgscanggrndvaffittagkkyvlsvytnape lqgeeralliasvaklarqyvvh
Timeline for d4mxgb_: